Nourishment

Vegan Raspberry and Chocolate Cheesecake

vegancheesecakesweetsdairy-freeraspberrieschocolate
Vegan Raspberry and Chocolate Cheesecake

Nutritional values / 100 g

165 kcal

Calories

4 g

Protein

25 g

Carbs

7 g

Fat

Ingredients

Crust:

  • 40 gdried plums
  • 30 mlsolid coconut oil
  • 100 goat flakes
  • 60 gpitted dates
  • 30 gsolid sweetener
  • a few dropswild berry extract

Cream:

  • 50 gwheat semolina
  • 2 cups (500 ml)water
  • 5 gagar-agar vegetable gelatin
  • 100 graspberries
  • 180 gtofu
  • 100 gsolid sweetener
  • 20 gsolid coconut oil
  • 40 gdark chocolate 50% cocoa
  • a few dropswild berry extract

Decoration:

  • to tasteraspberries
  • to tastechocolate

Preparation

  1. Soak the dried plums and dates in warm water for about 15 minutes, then drain well.
  2. Blend them together with the melted coconut oil, sweetener, extract, and oat flakes until you get a uniform mixture.
  3. Press the mixture into a 20 cm springform pan and refrigerate.
  4. Heat the water with the frozen raspberries until thawed, then blend to obtain a pink syrup.
  5. Add the semolina in a thin stream while stirring continuously, incorporate the agar-agar, and simmer over low heat for about 5 minutes.
  6. Remove from heat, add the coconut oil, extract, salt, and sweetener, stir, and briefly blend.
  7. Blend the tofu separately until creamy, then mix in 1/3 of the raspberry pudding to get a white-pinkish cream.
  8. Add the dark chocolate to the remaining pudding and alternately pour both creams over the crust for an attractive visual effect.
  9. Decorate with fresh raspberries and grated chocolate or chocolate flakes.
  10. Refrigerate for about 1 hour until firm, then slice and serve.

Recipe in pictures

Cheesecake cu ciocolata si zmeura - foto 1
Cheesecake cu ciocolata si zmeura - foto 2
Cheesecake cu ciocolata si zmeura - foto 3
Cheesecake cu ciocolata si zmeura - foto 4
Cheesecake cu ciocolata si zmeura - foto 5
Cheesecake cu ciocolata si zmeura - foto 6
Cheesecake cu ciocolata si zmeura - foto 7
Cheesecake cu ciocolata si zmeura - foto 8
Cheesecake cu ciocolata si zmeura - foto 9
Cheesecake cu ciocolata si zmeura - foto 10
Cheesecake cu ciocolata si zmeura - foto 11
Cheesecake cu ciocolata si zmeura - foto 12
Cheesecake cu ciocolata si zmeura - foto 13
Cheesecake cu ciocolata si zmeura - foto 14
Cheesecake cu ciocolata si zmeura - foto 15
Cheesecake cu ciocolata si zmeura - foto 16
Cheesecake cu ciocolata si zmeura - foto 17
Cheesecake cu ciocolata si zmeura - foto 18
Cheesecake cu ciocolata si zmeura - foto 19
Cheesecake cu ciocolata si zmeura - foto 20
Cheesecake cu ciocolata si zmeura - foto 21
Cheesecake cu ciocolata si zmeura - foto 22
Cheesecake cu ciocolata si zmeura - foto 23
Cheesecake cu ciocolata si zmeura - foto 24
Cheesecake cu ciocolata si zmeura - foto 25
Cheesecake cu ciocolata si zmeura - foto 26
Cheesecake cu ciocolata si zmeura - foto 27
Cheesecake cu ciocolata si zmeura - foto 28
Cheesecake cu ciocolata si zmeura - foto 29
Cheesecake cu ciocolata si zmeura - foto 30
Cheesecake cu ciocolata si zmeura - foto 31
Cheesecake cu ciocolata si zmeura - foto 32
Cheesecake cu ciocolata si zmeura - foto 33
Cheesecake cu ciocolata si zmeura - foto 34
Cheesecake cu ciocolata si zmeura - foto 35
Cheesecake cu ciocolata si zmeura - foto 36
© 2026 Raluca Găteşte